PDE4B polyclonal antibody
  • PDE4B polyclonal antibody

PDE4B polyclonal antibody

Ref: AB-PAB29528
PDE4B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human PDE4B.
Información adicional
Size 100 uL
Gene Name PDE4B
Gene Alias DKFZp686F2182|DPDE4|MGC126529|PDE4B5|PDEIVB
Gene Description phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKKKQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSHNRPLTCIMYAIFQERDLLKTFRISSDTFITYMMT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PDE4B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5142
Iso type IgG

Enviar un mensaje


PDE4B polyclonal antibody

PDE4B polyclonal antibody