Ver mas grande
BIRC5 polyclonal antibody
AB-PAB29524
Producto nuevo
BIRC5 polyclonal antibody
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | BIRC5 |
| Gene Alias | API4|EPR-1 |
| Gene Description | baculoviral IAP repeat-containing 5 |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,IHC-P |
| Immunogen Prot. Seq | MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETA |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (1:1000-1:2500)<br>Western Blot (1:100-1:250)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to human BIRC5. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene ID | 332 |
| Iso type | IgG |
Más información
Rabbit polyclonal antibody raised against recombinant human BIRC5.