BIRC5 polyclonal antibody
  • BIRC5 polyclonal antibody

BIRC5 polyclonal antibody

Ref: AB-PAB29524
BIRC5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human BIRC5.
Información adicional
Size 100 uL
Gene Name BIRC5
Gene Alias API4|EPR-1
Gene Description baculoviral IAP repeat-containing 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETA
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human BIRC5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 332
Iso type IgG

Enviar un mensaje


BIRC5 polyclonal antibody

BIRC5 polyclonal antibody