TLR8 polyclonal antibody
  • TLR8 polyclonal antibody

TLR8 polyclonal antibody

Ref: AB-PAB29521
TLR8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human TLR8.
Información adicional
Size 100 uL
Gene Name TLR8
Gene Alias CD288|MGC119599|MGC119600
Gene Description toll-like receptor 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RSYPCDEKKQNDSVIAECSNRRLQEVPQTVGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNVQHQNGNPGIQSNGLNITDGAFLNLKNLRELLLEDNQLPQIPSGLPESLTELSL
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TLR8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51311
Iso type IgG

Enviar un mensaje


TLR8 polyclonal antibody

TLR8 polyclonal antibody