TF polyclonal antibody
  • TF polyclonal antibody

TF polyclonal antibody

Ref: AB-PAB29519
TF polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human TF.
Información adicional
Size 100 uL
Gene Name TF
Gene Alias DKFZp781D0156|PRO1557|PRO2086
Gene Description transferrin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq DGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKA
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TF.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7018
Iso type IgG

Enviar un mensaje


TF polyclonal antibody

TF polyclonal antibody