FES polyclonal antibody
  • FES polyclonal antibody

FES polyclonal antibody

Ref: AB-PAB29516
FES polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human FES.
Información adicional
Size 100 uL
Gene Name FES
Gene Alias FPS
Gene Description feline sarcoma oncogene
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq DSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human FES.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2242
Iso type IgG

Enviar un mensaje


FES polyclonal antibody

FES polyclonal antibody