BRAF polyclonal antibody
  • BRAF polyclonal antibody

BRAF polyclonal antibody

Ref: AB-PAB29515
BRAF polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human BRAF.
Información adicional
Size 100 uL
Gene Name BRAF
Gene Alias B-RAF1|BRAF1|FLJ95109|MGC126806|MGC138284|RAFB1
Gene Description v-raf murine sarcoma viral oncogene homolog B1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human BRAF.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 673
Iso type IgG

Enviar un mensaje


BRAF polyclonal antibody

BRAF polyclonal antibody