C4BPA polyclonal antibody
  • C4BPA polyclonal antibody

C4BPA polyclonal antibody

Ref: AB-PAB29511
C4BPA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human C4BPA.
Información adicional
Size 100 uL
Gene Name C4BPA
Gene Alias C4BP|PRP
Gene Description complement component 4 binding protein, alpha
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELVNGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQST
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human C4BPA.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 722
Iso type IgG

Enviar un mensaje


C4BPA polyclonal antibody

C4BPA polyclonal antibody