PCIF1 polyclonal antibody
  • PCIF1 polyclonal antibody

PCIF1 polyclonal antibody

Ref: AB-PAB29502
PCIF1 polyclonal antibody

Información del producto

PCIF1 polyclonal antibody raised against recombinant human PCIF1.
Información adicional
Size 100 uL
Gene Name PCIF1
Gene Alias C20orf67
Gene Description PDX1 C-terminal inhibiting factor 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SSLVETPPAENKPRKRQLSEEQPSGNGVKKPKIEIPVTPTGQSVPSSPSIPGTPTLKMWGTSPEDKQQAALLRPTEVYWDLDIQTNAVIKHR
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PCIF1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 63935
Iso type IgG

Enviar un mensaje


PCIF1 polyclonal antibody

PCIF1 polyclonal antibody