TCF3 polyclonal antibody
  • TCF3 polyclonal antibody

TCF3 polyclonal antibody

Ref: AB-PAB29500
TCF3 polyclonal antibody

Información del producto

TCF3 polyclonal antibody raised against recombinant human TCF3.
Información adicional
Size 100 uL
Gene Name TCF3
Gene Alias E2A|ITF1|MGC129647|MGC129648|bHLHb21
Gene Description transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq RTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPS
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TCF3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6929
Iso type IgG

Enviar un mensaje


TCF3 polyclonal antibody

TCF3 polyclonal antibody