NCAM1 polyclonal antibody
  • NCAM1 polyclonal antibody

NCAM1 polyclonal antibody

Ref: AB-PAB29492
NCAM1 polyclonal antibody

Información del producto

NCAM1 polyclonal antibody raised against recombinant human NCAM1.
Información adicional
Size 100 uL
Gene Name NCAM1
Gene Alias CD56|MSK39|NCAM
Gene Description neural cell adhesion molecule 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq DSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAK
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NCAM1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4684
Iso type IgG

Enviar un mensaje


NCAM1 polyclonal antibody

NCAM1 polyclonal antibody