CD207 polyclonal antibody
  • CD207 polyclonal antibody

CD207 polyclonal antibody

Ref: AB-PAB29488
CD207 polyclonal antibody

Información del producto

CD207 polyclonal antibody raised against recombinant human CD207.
Información adicional
Size 100 uL
Gene Name CD207
Gene Alias CLEC4K
Gene Description CD207 molecule, langerin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq VKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAEIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIP
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CD207.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 50489
Iso type IgG

Enviar un mensaje


CD207 polyclonal antibody

CD207 polyclonal antibody