COPB1 polyclonal antibody
  • COPB1 polyclonal antibody

COPB1 polyclonal antibody

Ref: AB-PAB29484
COPB1 polyclonal antibody

Información del producto

COPB1 polyclonal antibody raised against recombinant human COPB1.
Información adicional
Size 100 uL
Gene Name COPB1
Gene Alias COPB|DKFZp761K102|FLJ10341
Gene Description coatomer protein complex, subunit beta 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq NKVTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKT
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human COPB1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1315
Iso type IgG

Enviar un mensaje


COPB1 polyclonal antibody

COPB1 polyclonal antibody