CAND1 polyclonal antibody
  • CAND1 polyclonal antibody

CAND1 polyclonal antibody

Ref: AB-PAB29483
CAND1 polyclonal antibody

Información del producto

CAND1 polyclonal antibody raised against recombinant human CAND1.
Información adicional
Size 100 uL
Gene Name CAND1
Gene Alias DKFZp434M1414|FLJ10114|FLJ10929|FLJ38691|FLJ90441|KIAA0829|TIP120|TIP120A
Gene Description cullin-associated and neddylation-dissociated 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq QTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPG
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:1000-1:2500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CAND1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55832
Iso type IgG

Enviar un mensaje


CAND1 polyclonal antibody

CAND1 polyclonal antibody