PELI3 polyclonal antibody
  • PELI3 polyclonal antibody

PELI3 polyclonal antibody

Ref: AB-PAB29481
PELI3 polyclonal antibody

Información del producto

PELI3 polyclonal antibody raised against recombinant human PELI3.
Información adicional
Size 100 uL
Gene Name PELI3
Gene Alias MGC35521
Gene Description pellino homolog 3 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq RSRLALSRRSHANGVKPDVMHHISTPLVSKALSNRGQ
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PELI3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 246330
Iso type IgG

Enviar un mensaje


PELI3 polyclonal antibody

PELI3 polyclonal antibody