Ver mas grande
TPD52 polyclonal antibody
AB-PAB29480
Producto nuevo
TPD52 polyclonal antibody
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | TPD52 |
| Gene Alias | D52|N8L|PC-1|PrLZ|hD52 |
| Gene Description | tumor protein D52 |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB,IHC-P,IF |
| Immunogen Prot. Seq | KSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL |
| Form | Liquid |
| Recomended Dilution | Immunofluorescence (1-4 ug/mL)<br>Immunohistochemistry (1:50-1:200)<br>Western Blot (1:100-1:250)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids of human TPD52. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene ID | 7163 |
| Iso type | IgG |
Más información
TPD52 polyclonal antibody raised against recombinant human TPD52.