TPD52 polyclonal antibody
  • TPD52 polyclonal antibody

TPD52 polyclonal antibody

Ref: AB-PAB29480
TPD52 polyclonal antibody

Información del producto

TPD52 polyclonal antibody raised against recombinant human TPD52.
Información adicional
Size 100 uL
Gene Name TPD52
Gene Alias D52|N8L|PC-1|PrLZ|hD52
Gene Description tumor protein D52
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq KSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TPD52.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7163
Iso type IgG

Enviar un mensaje


TPD52 polyclonal antibody

TPD52 polyclonal antibody