GAR1 polyclonal antibody
  • GAR1 polyclonal antibody

GAR1 polyclonal antibody

Ref: AB-PAB29476
GAR1 polyclonal antibody

Información del producto

GAR1 polyclonal antibody raised against recombinant human GAR1.
Información adicional
Size 100 uL
Gene Name GAR1
Gene Alias NOLA1
Gene Description GAR1 ribonucleoprotein homolog (yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P,IF
Immunogen Prot. Seq GRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTT
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GAR1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54433
Iso type IgG

Enviar un mensaje


GAR1 polyclonal antibody

GAR1 polyclonal antibody