CLK2 polyclonal antibody
  • CLK2 polyclonal antibody

CLK2 polyclonal antibody

Ref: AB-PAB29463
CLK2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human CLK2.
Información adicional
Size 100 uL
Gene Name CLK2
Gene Alias MGC61500|hCLK2
Gene Description CDC-like kinase 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq HPRRYHSSERGSRGSYREHYRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSYDDRSSDR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CLK2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1196
Iso type IgG

Enviar un mensaje


CLK2 polyclonal antibody

CLK2 polyclonal antibody