CDC20 polyclonal antibody
  • CDC20 polyclonal antibody

CDC20 polyclonal antibody

Ref: AB-PAB29462
CDC20 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human CDC20.
Información adicional
Size 100 uL
Gene Name CDC20
Gene Alias CDC20A|MGC102824|bA276H19.3|p55CDC
Gene Description cell division cycle 20 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq TPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDY
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CDC20.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 991
Iso type IgG

Enviar un mensaje


CDC20 polyclonal antibody

CDC20 polyclonal antibody