IRAK1 polyclonal antibody
  • IRAK1 polyclonal antibody

IRAK1 polyclonal antibody

Ref: AB-PAB29458
IRAK1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human IRAK1.
Información adicional
Size 100 uL
Gene Name IRAK1
Gene Alias IRAK|pelle
Gene Description interleukin-1 receptor-associated kinase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq GAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human IRAK1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3654
Iso type IgG

Enviar un mensaje


IRAK1 polyclonal antibody

IRAK1 polyclonal antibody