C1orf57 polyclonal antibody
  • C1orf57 polyclonal antibody

C1orf57 polyclonal antibody

Ref: AB-PAB29457
C1orf57 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human C1orf57.
Información adicional
Size 100 uL
Gene Name C1orf57
Gene Alias FLJ11383|MGC13186|RP4-678E16.2
Gene Description chromosome 1 open reading frame 57
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human C1orf57.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84284
Iso type IgG

Enviar un mensaje


C1orf57 polyclonal antibody

C1orf57 polyclonal antibody