OIP5 polyclonal antibody
  • OIP5 polyclonal antibody

OIP5 polyclonal antibody

Ref: AB-PAB29445
OIP5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human OIP5.
Información adicional
Size 100 uL
Gene Name OIP5
Gene Alias 5730547N13Rik|LINT-25|MIS18beta
Gene Description Opa interacting protein 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq CGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human OIP5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 11339
Iso type IgG

Enviar un mensaje


OIP5 polyclonal antibody

OIP5 polyclonal antibody