BRD3 polyclonal antibody
  • BRD3 polyclonal antibody

BRD3 polyclonal antibody

Ref: AB-PAB29443
BRD3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human BRD3.
Información adicional
Size 100 uL
Gene Name BRD3
Gene Alias FLJ23227|FLJ41328|KIAA0043|ORFX|RING3L
Gene Description bromodomain containing 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq MPQEEVELLPPAPKGKGRKPAAGAQSAGTQQVAAVSSVSPATPFQSVPPTVSQTPVIAATPVPTITANVTSV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human BRD3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8019
Iso type IgG

Enviar un mensaje


BRD3 polyclonal antibody

BRD3 polyclonal antibody