DBN1 polyclonal antibody
  • DBN1 polyclonal antibody

DBN1 polyclonal antibody

Ref: AB-PAB29439
DBN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human DBN1.
Información adicional
Size 100 uL
Gene Name DBN1
Gene Alias D0S117E|DKFZp434D064
Gene Description drebrin 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAEDLMFMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTVANNVPPAATSLIDLWP
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DBN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1627
Iso type IgG

Enviar un mensaje


DBN1 polyclonal antibody

DBN1 polyclonal antibody