RCN3 polyclonal antibody
  • RCN3 polyclonal antibody

RCN3 polyclonal antibody

Ref: AB-PAB29427
RCN3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human RCN3.
Información adicional
Size 100 uL
Gene Name RCN3
Gene Alias RLP49
Gene Description reticulocalbin 3, EF-hand calcium binding domain
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq EFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDL
Form Liquid
Recomended Dilution Immunohistochemistry (1:2500-1:5000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RCN3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57333
Iso type IgG

Enviar un mensaje


RCN3 polyclonal antibody

RCN3 polyclonal antibody