CTNNB1 polyclonal antibody
  • CTNNB1 polyclonal antibody

CTNNB1 polyclonal antibody

Ref: AB-PAB29422
CTNNB1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human CTNNB1.
Información adicional
Size 100 uL
Gene Name CTNNB1
Gene Alias CTNNB|DKFZp686D02253|FLJ25606|FLJ37923
Gene Description catenin (cadherin-associated protein), beta 1, 88kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq SYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CTNNB1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1499
Iso type IgG

Enviar un mensaje


CTNNB1 polyclonal antibody

CTNNB1 polyclonal antibody