PVRL1 polyclonal antibody
  • PVRL1 polyclonal antibody

PVRL1 polyclonal antibody

Ref: AB-PAB29417
PVRL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human PVRL1.
Información adicional
Size 100 uL
Gene Name PVRL1
Gene Alias CD111|CLPED1|ED4|HIgR|HVEC|MGC142031|MGC16207|OFC7|PRR|PRR1|PVRR|PVRR1|SK-12|nectin-1
Gene Description poliovirus receptor-related 1 (herpesvirus entry mediator C)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq DSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAKPTNWIEGTQAVLRAKKGQDD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PVRL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5818
Iso type IgG

Enviar un mensaje


PVRL1 polyclonal antibody

PVRL1 polyclonal antibody