RPL9 polyclonal antibody
  • RPL9 polyclonal antibody

RPL9 polyclonal antibody

Ref: AB-PAB29404
RPL9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human RPL9.
Información adicional
Size 100 uL
Gene Name RPL9
Gene Alias DKFZp313J1510|FLJ27456|MGC15545|NPC-A-16
Gene Description ribosomal protein L9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq SVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE
Form Liquid
Recomended Dilution Immunohistochemistry
Immunofluorescence (1-4 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RPL9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6133
Iso type IgG

Enviar un mensaje


RPL9 polyclonal antibody

RPL9 polyclonal antibody