FBXO44 polyclonal antibody
  • FBXO44 polyclonal antibody

FBXO44 polyclonal antibody

Ref: AB-PAB29402
FBXO44 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human FBXO44.
Información adicional
Size 100 uL
Gene Name FBXO44
Gene Alias DKFZp781J0852|FBG3|FBX30|FBX6A|Fbx44|Fbxo6a|MGC14140
Gene Description F-box protein 44
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq SLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQVRSQARLRVQVPAVRSAPVVRARASGDLPARPGDHPAEERCQVEGGLPHILQLP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human FBXO44.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 93611
Iso type IgG

Enviar un mensaje


FBXO44 polyclonal antibody

FBXO44 polyclonal antibody