SP2 polyclonal antibody
  • SP2 polyclonal antibody

SP2 polyclonal antibody

Ref: AB-PAB29400
SP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human SP2.
Información adicional
Size 100 uL
Gene Name SP2
Gene Alias -
Gene Description Sp2 transcription factor
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq KLVPIKPAPLPLSPGKNSFGILSSKGNILQIQGSQLSASYPGGQLVFAIQNPTMINKGTRSNANIQYQAVPQIQASNSQTIQVQPNLTNQIQIIPGTNQAIITPSPSSHKPVPIKPAPIQKSST
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6668
Iso type IgG

Enviar un mensaje


SP2 polyclonal antibody

SP2 polyclonal antibody