ZNF74 polyclonal antibody
  • ZNF74 polyclonal antibody

ZNF74 polyclonal antibody

Ref: AB-PAB29399
ZNF74 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human ZNF74.
Información adicional
Size 100 uL
Gene Name ZNF74
Gene Alias Cos52|ZNF520|Zfp520
Gene Description zinc finger protein 74
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq GEKPFDCSQCWKAFSCHSSLIVHQRIHTGEKPYKCSECGRAFSQNHCLIKHQKIHSGEKSFKCEKCGEMFNWSSHLTEHQRLHSEGKPLAIQFNKHLLSTYYVPGSLLGAGDAGLRDVDPIDALDVAKLLCVVP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ZNF74.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7625
Iso type IgG

Enviar un mensaje


ZNF74 polyclonal antibody

ZNF74 polyclonal antibody