S100A10 polyclonal antibody
  • S100A10 polyclonal antibody

S100A10 polyclonal antibody

Ref: AB-PAB29397
S100A10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human S100A10.
Información adicional
Size 100 uL
Gene Name S100A10
Gene Alias 42C|ANX2L|ANX2LG|CAL1L|CLP11|Ca[1]|GP11|MGC111133|P11|p10
Gene Description S100 calcium binding protein A10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human S100A10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6281
Iso type IgG

Enviar un mensaje


S100A10 polyclonal antibody

S100A10 polyclonal antibody