GABPA polyclonal antibody
  • GABPA polyclonal antibody

GABPA polyclonal antibody

Ref: AB-PAB29389
GABPA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human GABPA.
Información adicional
Size 100 uL
Gene Name GABPA
Gene Alias E4TF1-60|E4TF1A|NFT2|NRF2|NRF2A
Gene Description GA binding protein transcription factor, alpha subunit 60kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq EELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQCSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTVEVVIDPDAHHAESEAHLVEEAQVITLDGTK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human GABPA.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2551
Iso type IgG

Enviar un mensaje


GABPA polyclonal antibody

GABPA polyclonal antibody