PDIA3 polyclonal antibody
  • PDIA3 polyclonal antibody

PDIA3 polyclonal antibody

Ref: AB-PAB29388
PDIA3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human PDIA3.
Información adicional
Size 100 uL
Gene Name PDIA3
Gene Alias ER60|ERp57|ERp60|ERp61|GRP57|GRP58|HsT17083|P58|PI-PLC
Gene Description protein disulfide isomerase family A, member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK
Form Liquid
Recomended Dilution Immunohistochemistry (1:2500-1:5000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PDIA3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2923
Iso type IgG

Enviar un mensaje


PDIA3 polyclonal antibody

PDIA3 polyclonal antibody