SIPA1L1 polyclonal antibody
  • SIPA1L1 polyclonal antibody

SIPA1L1 polyclonal antibody

Ref: AB-PAB29380
SIPA1L1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human SIPA1L1.
Información adicional
Size 100 uL
Gene Name SIPA1L1
Gene Alias DKFZp686G1344|E6TP1|KIAA0440
Gene Description signal-induced proliferation-associated 1 like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq IRQRSNSDITISELDVDSFDECISPTYKTGPSLHREYGSTSSIDKQGTSGESFFDLLKGYKDDKSDRGPTPTKLSDFLITGGGKGSGFSLDVIDGPISQRENLRLFKEREKPLKRRSKSETGDSSIFRKLRNAKGEELGKSSDLEDNRSE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SIPA1L1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26037
Iso type IgG

Enviar un mensaje


SIPA1L1 polyclonal antibody

SIPA1L1 polyclonal antibody