LIG4 polyclonal antibody
  • LIG4 polyclonal antibody

LIG4 polyclonal antibody

Ref: AB-PAB29363
LIG4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human LIG4.
Información adicional
Size 100 uL
Gene Name LIG4
Gene Alias -
Gene Description ligase IV, DNA, ATP-dependent
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq TYCVIAGSENIRVKNIILSNKHDVVKPAWLLECFKTKSFVPWQPRFMIHMCPSTKEHFAREYDCYGDSYFIDTDLNQLKEVFSGIKNSNEQTPEEMASLIADLEYRYSWDCSPLSMFRRHTVYLDSYA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human LIG4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3981
Iso type IgG

Enviar un mensaje


LIG4 polyclonal antibody

LIG4 polyclonal antibody