HIF1A polyclonal antibody
  • HIF1A polyclonal antibody

HIF1A polyclonal antibody

Ref: AB-PAB29359
HIF1A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human HIF1A.
Información adicional
Size 100 uL
Gene Name HIF1A
Gene Alias HIF-1alpha|HIF1|HIF1-ALPHA|MOP1|PASD8|bHLHe78
Gene Description hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq KSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human HIF1A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3091
Iso type IgG

Enviar un mensaje


HIF1A polyclonal antibody

HIF1A polyclonal antibody