CD34 polyclonal antibody
  • CD34 polyclonal antibody

CD34 polyclonal antibody

Ref: AB-PAB29333
CD34 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human CD34.
Información adicional
Size 100 uL
Gene Name CDC34
Gene Alias E2-CDC34|UBC3|UBE2R1
Gene Description cell division cycle 34 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq LNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CD34.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 997
Iso type IgG

Enviar un mensaje


CD34 polyclonal antibody

CD34 polyclonal antibody