CUL5 polyclonal antibody
  • CUL5 polyclonal antibody

CUL5 polyclonal antibody

Ref: AB-PAB29330
CUL5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human CUL5.
Información adicional
Size 100 uL
Gene Name CUL5
Gene Alias VACM-1|VACM1
Gene Description cullin 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq FSLMDKVPNGIEPMLKDLEEHIISAGLADMVAAAETITTDSEKYVEQLLTLFNRFSKLVKEAFQDDPRFLTARDKAYKAVVNDATIFKLELPLKQKGVGLKTQPESKCPELLANYCDMLLRK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CUL5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8065
Iso type IgG

Enviar un mensaje


CUL5 polyclonal antibody

CUL5 polyclonal antibody