PFKM polyclonal antibody
  • PFKM polyclonal antibody

PFKM polyclonal antibody

Ref: AB-PAB29329
PFKM polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human PFKM.
Información adicional
Size 100 uL
Gene Name PFKM
Gene Alias GSD7|MGC8699|PFK-1|PFK-M|PFKX
Gene Description phosphofructokinase, muscle
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq CVQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQISA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PFKM.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5213
Iso type IgG

Enviar un mensaje


PFKM polyclonal antibody

PFKM polyclonal antibody