TNFAIP3 polyclonal antibody
  • TNFAIP3 polyclonal antibody

TNFAIP3 polyclonal antibody

Ref: AB-PAB29328
TNFAIP3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human TNFAIP3.
Información adicional
Size 100 uL
Gene Name TNFAIP3
Gene Alias A20|MGC104522|MGC138687|MGC138688|OTUD7C|TNFA1P2
Gene Description tumor necrosis factor, alpha-induced protein 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq QECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDRGRFEDLKVHFLTDPENEMKEKLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKW
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TNFAIP3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7128
Iso type IgG

Enviar un mensaje


TNFAIP3 polyclonal antibody

TNFAIP3 polyclonal antibody