C1QTNF6 polyclonal antibody
  • C1QTNF6 polyclonal antibody

C1QTNF6 polyclonal antibody

Ref: AB-PAB29325
C1QTNF6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human C1QTNF6.
Información adicional
Size 100 uL
Gene Name C1QTNF6
Gene Alias CTRP6|ZACRP6
Gene Description C1q and tumor necrosis factor related protein 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq CQRCCDSEDPLDPAHVSSASSSGRPHALPEIRPYINITILKGDKGDPGPMGLPGYMGREGPQGEPGPQGSKGDKGEMGSPGAPCQKRFFAFSVGRKTALHSGEDFQTLLFERVFVNLDGCFDMATGQFAAPLR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C1QTNF6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 114904
Iso type IgG

Enviar un mensaje


C1QTNF6 polyclonal antibody

C1QTNF6 polyclonal antibody