IGF2BP3 polyclonal antibody
  • IGF2BP3 polyclonal antibody

IGF2BP3 polyclonal antibody

Ref: AB-PAB29324
IGF2BP3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human IGF2BP3.
Información adicional
Size 100 uL
Gene Name IGF2BP3
Gene Alias DKFZp686F1078|IMP-3|IMP3|KOC1|VICKZ3
Gene Description insulin-like growth factor 2 mRNA binding protein 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq VVESCEQVNTDSETAVVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIPDEMAAQQNPLQQPRGRRGLGQRGSSRQGSPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQTQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IGF2BP3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10643
Iso type IgG

Enviar un mensaje


IGF2BP3 polyclonal antibody

IGF2BP3 polyclonal antibody