CLOCK polyclonal antibody
  • CLOCK polyclonal antibody

CLOCK polyclonal antibody

Ref: AB-PAB29318
CLOCK polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human CLOCK.
Información adicional
Size 100 uL
Gene Name CLOCK
Gene Alias KAT13D|KIAA0334|bHLHe8
Gene Description clock homolog (mouse)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq RQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQVVPTNQIQSGMNTGHIGTTQHMIQQQTLQSTSTQSQQNVLSGHSQQTSLPSQTQSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CLOCK.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9575
Iso type IgG

Enviar un mensaje


CLOCK polyclonal antibody

CLOCK polyclonal antibody