MLLT3 polyclonal antibody
  • MLLT3 polyclonal antibody

MLLT3 polyclonal antibody

Ref: AB-PAB29315
MLLT3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human MLLT3.
Información adicional
Size 100 uL
Gene Name MLLT3
Gene Alias AF9|FLJ2035|YEATS3
Gene Description myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq SSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEVEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MLLT3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4300
Iso type IgG

Enviar un mensaje


MLLT3 polyclonal antibody

MLLT3 polyclonal antibody