MMP9 polyclonal antibody
  • MMP9 polyclonal antibody

MMP9 polyclonal antibody

Ref: AB-PAB29310
MMP9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human MMP9.
Información adicional
Size 100 uL
Gene Name MMP9
Gene Alias CLG4B|GELB|MMP-9
Gene Description matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq PRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADI
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 21-166 of human MMP9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4318
Iso type IgG

Enviar un mensaje


MMP9 polyclonal antibody

MMP9 polyclonal antibody