PIK3R1 polyclonal antibody
  • PIK3R1 polyclonal antibody

PIK3R1 polyclonal antibody

Ref: AB-PAB29309
PIK3R1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human PIK3R1.
Información adicional
Size 100 uL
Gene Name PIK3R1
Gene Alias GRB1|p85|p85-ALPHA
Gene Description phosphoinositide-3-kinase, regulatory subunit 1 (alpha)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq LADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNERQPAPALPPKPPKPTTVANNGMNNNMSL
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 182-328 of human PIK3R1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5295
Iso type IgG

Enviar un mensaje


PIK3R1 polyclonal antibody

PIK3R1 polyclonal antibody