ZNF773 polyclonal antibody
  • ZNF773 polyclonal antibody

ZNF773 polyclonal antibody

Ref: AB-PAB28746
ZNF773 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF773.
Información adicional
Size 100 uL
Gene Name ZNF773
Gene Alias FLJ00301|MGC4728|ZNF419B
Gene Description zinc finger protein 773
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC
Immunogen Prot. Seq EITQLESWEEPFMPAWEVVTSAILRGSWQGAKAEAAAEQSASVEVPSSNVQQHQKQHCGEKPLKRQEGRVPVLRSCRVHLSEKSLQSREVGKDLLTSSGVLKHQVTHTGEKSHRSSKSRE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF773.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 374928
Iso type IgG

Enviar un mensaje


ZNF773 polyclonal antibody

ZNF773 polyclonal antibody