SULT4A1 polyclonal antibody
  • SULT4A1 polyclonal antibody

SULT4A1 polyclonal antibody

Ref: AB-PAB28739
SULT4A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SULT4A1.
Información adicional
Size 100 uL
Gene Name SULT4A1
Gene Alias BR-STL-1|BRSTL1|DJ388M5.3|MGC40032|NST|SULTX3|hBR-STL-1
Gene Description sulfotransferase family 4A, member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC
Immunogen Prot. Seq GEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSL
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:100-1:250 )
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SULT4A1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 25830
Iso type IgG

Enviar un mensaje


SULT4A1 polyclonal antibody

SULT4A1 polyclonal antibody