PLXNB2 polyclonal antibody
  • PLXNB2 polyclonal antibody

PLXNB2 polyclonal antibody

Ref: AB-PAB28733
PLXNB2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PLXNB2.
Información adicional
Size 100 uL
Gene Name PLXNB2
Gene Alias KIAA0315|MM1|Nbla00445|PLEXB2|dJ402G11.3
Gene Description plexin B2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC
Immunogen Prot. Seq DSPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQYTQKYYDEIINALEEDPAAQKMQLAFRLQQIAAALENKVTD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PLXNB2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 23654
Iso type IgG

Enviar un mensaje


PLXNB2 polyclonal antibody

PLXNB2 polyclonal antibody