BEGAIN polyclonal antibody
  • BEGAIN polyclonal antibody

BEGAIN polyclonal antibody

Ref: AB-PAB28732
BEGAIN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BEGAIN.
Información adicional
Size 100 uL
Gene Name BEGAIN
Gene Alias KIAA1446
Gene Description brain-enriched guanylate kinase-associated homolog (rat)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC,IF
Immunogen Prot. Seq PYPAETFRFPASPGPQQALMPPNLWSLRAKPGTARLPGEDMRGQWRPLSVEDIGAYSYPVSAAGRASPCSFSERYYGGAGGSPGKKADGRASPLYASYKADSFSEGDDLSQGHLAEPCFLRAGGDLSLSPGRSADPLPGYAPSE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/ml)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BEGAIN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 57596
Iso type IgG

Enviar un mensaje


BEGAIN polyclonal antibody

BEGAIN polyclonal antibody